PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000290156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 374aa    MW: 40848.3 Da    PI: 6.443
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000290156genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17261295135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  MDP0000290156 261 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 295
                    99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-8123351IPR016679Transcription factor, GATA, plant
SMARTSM004017.9E-16255305IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.255255291IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-15258319No hitNo description
Gene3DG3DSA:3.30.50.103.4E-14259293IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.57E-14260307No hitNo description
PROSITE patternPS003440261286IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15261295IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEAPEYYQNS FCPQFTPEKR HPFDNNKTAV GGGGGDHFKV EDLLDFSNDD DDVITDGGCS  60
AAAAFENVAG NSTDSSTLTV MDSCNSSSLS GSEPIFGSRN LADGPLSSEL CVPYDDLAEL  120
EWLSNFVEES FSSEDLQKLQ LISGMKARPD EAASETGQLQ PDPTRTNNNP YSNSNPIFNP  180
EVSVPAKARS KRSRASPCNW TSRILVLSST KEQSDVLVSA EEAATLLPQP SSTGKKSVKS  240
APKKKESQEG SGGGPCDGRK CLHCATDKTP QWRTGPMGPK TLCNACGVRY KSGRLVPEYR  300
PAASPTFVLT KHSNSHRKVL ELRRQKEMGR AQQTYIHQVP PPHHHHHQNM VFDVSNGGDY  360
LIHQHVGPDF RQLI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.108280.0bud| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393856.10.0PREDICTED: GATA transcription factor 12-like
SwissprotP697817e-95GAT12_ARATH; GATA transcription factor 12
TrEMBLD9ZIY70.0D9ZIY7_MALDO; GATA domain class transcription factor
STRINGVIT_04s0008g03270.t011e-148(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-91GATA transcription factor 12